PEA15 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PEA15

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: DYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Astrocytic phosphoprotein PEA-15

Protein Size: 130

Purification: Affinity Purified

• Artikelnummer: AVIARP58923_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58923_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 8682
• Wirt: Rabbit
• Konjugat: Conjugated, HRP