PEF1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1; MIM 114170), sorcin (SRI; MIM 182520), grancalcin (GCA; MIM 607030), and ALG2.PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1; MIM 114170), sorcin (SRI; MIM 182520), grancalcin (GCA; MIM 607030), and ALG2 (PDCD6; MIM 601057) (Kitaura et al., 2001 [PubMed 11278427]).[supplied by OMIM]. Sequence Note: removed 1 base from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1640 AB026628.1 1-1640

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEF1

Key Reference: Jordanova,A., (2006) Nat. Genet. 38 (2), 197-202

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peflin

Protein Size: 284

Purification: Affinity Purified

• Artikelnummer: AVIARP58512_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58512_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 553115
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin