PEF1 Antibody - middle region : FITC

PEF1 Antibody - middle region : FITC
Artikelnummer
AVIARP58512_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1; MIM 114170), sorcin (SRI; MIM 182520), grancalcin (GCA; MIM 607030), and ALG2.PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1; MIM 114170), sorcin (SRI; MIM 182520), grancalcin (GCA; MIM 607030), and ALG2 (PDCD6; MIM 601057) (Kitaura et al., 2001 [PubMed 11278427]).[supplied by OMIM]. Sequence Note: removed 1 base from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1640 AB026628.1 1-1640

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEF1

Key Reference: Jordanova,A., (2006) Nat. Genet. 38 (2), 197-202

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peflin

Protein Size: 284

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58512_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58512_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 553115
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×