PEX26 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes. It anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into pero

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEX26

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxisome assembly protein 26

Protein Size: 305

Purification: Affinity Purified

• Artikelnummer: AVIARP57068_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57068_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55670
• Wirt: Rabbit