PEX7 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PEX7

Key Reference: Arning,L., (er) J. Mol. Med. (2008) In press

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peroxisomal targeting signal 2 receptor

Protein Size: 323

Purification: Affinity Purified

• Artikelnummer: AVIARP56091_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56091_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5191
• Wirt: Rabbit