PFDN2 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PFD2

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: ETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: prefoldin subunit 2

Protein Size: 154

Purification: Affinity Purified

• Artikelnummer: AVIARP56736_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56736_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5202
• Wirt: Rabbit