PFDN2 Antibody - middle region : FITC

PFDN2 Antibody - middle region : FITC
Artikelnummer
AVIARP56735_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PFDN2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: LTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prefoldin subunit 2

Protein Size: 154

Purification: Affinity Purified

Subunit: 2
Mehr Informationen
Artikelnummer AVIARP56735_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56735_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5202
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×