PGLS Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PGLS

Key Reference: Miclet,E., (2001) J. Biol. Chem. 276 (37), 34840-34846

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 6-phosphogluconolactonase

Protein Size: 258

Purification: Affinity Purified

• Artikelnummer: AVIARP58513_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58513_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 25796
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin