English
PGM2L1 Antibody - N-terminal region : Biotin
PGM2L1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55658_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: PGM2L1 is the Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. PGM2L1 has only low phosphopentomutase and phosphoglucomutase activities.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PGM2L1
Key Reference: Maliekal,P., (2007) J. Biol. Chem. 282 (44), 31844-31851
Molecular Weight: 70kDa
Peptide Sequence: Synthetic peptide located within the following region: KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Glucose 1,6-bisphosphate synthase
Protein Size: 622
Purification: Affinity Purified
Description of Target: PGM2L1 is the Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. PGM2L1 has only low phosphopentomutase and phosphoglucomutase activities.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PGM2L1
Key Reference: Maliekal,P., (2007) J. Biol. Chem. 282 (44), 31844-31851
Molecular Weight: 70kDa
Peptide Sequence: Synthetic peptide located within the following region: KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Glucose 1,6-bisphosphate synthase
Protein Size: 622
Purification: Affinity Purified
| Artikelnummer | AVIARP55658_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55658_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 283209 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
