PGM3 Antibody - N-terminal region : HRP

PGM3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56755_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PGM3

Key Reference: Woo,S.Y., (2007) J. Biol. Chem. 282 (35), 25604-25612

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphoacetylglucosamine mutase

Protein Size: 542

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56755_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56755_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5238
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×