PH-4 Antibody - middle region : HRP

PH-4 Antibody - middle region : HRP
Artikelnummer
AVIARP57762_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. It plays a role in adaptation to hypoxia and m

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PH-4

Key Reference: Koivunen,P., (2007) J. Biol. Chem. 282 (42), 30544-30552

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transmembrane prolyl 4-hydroxylase

Protein Size: 502

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57762_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57762_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54681
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×