Phkg1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Phkg1 is a catalytic subunit of phosphorylase kinase complex; It plays a role in glycogen metabolism.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: REATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform

Protein Size: 388

Purification: Affinity Purified

• Artikelnummer: AVIARP56680_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56680_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 29353
• Wirt: Rabbit