PHLDA2 Antibody - middle region : FITC

PHLDA2 Antibody - middle region : FITC
Artikelnummer
AVIARP58237_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHLDA2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pleckstrin homology-like domain family A member 2

Protein Size: 152

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58237_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58237_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 7262
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×