PHYH Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have b

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHYH

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phytanoyl-CoA dioxygenase, peroxisomal

Protein Size: 338

Purification: Affinity Purified

• Artikelnummer: AVIARP56682_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56682_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5264
• Wirt: Rabbit