PI16 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PI16

Key Reference: Reeves,J.R., Clin. Cancer Res. 12 (20 PT 1), 6018-6022 (2006)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peptidase inhibitor 16

Protein Size: 463

Purification: Affinity Purified

• Artikelnummer: AVIARP55590_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55590_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Dog (Canine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 221476
• Wirt: Rabbit