PIDD1 Antibody - middle region : FITC

PIDD1 Antibody - middle region : FITC
Artikelnummer
AVIARP57270_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene contains a leucine-rich repeat and a death domain. This protein has been shown to interact with other death domain proteins, such as Fas (TNFRSF6)-associated via death domain (FADD) and MAP-kinase activating death domain-containing protein (MADD), and thus may function as an adaptor protein in cell death-related signaling processes. The expression of the mouse counterpart of this gene has been found to be positively regulated by the tumor suppressor p53 and to induce cell apoptosis in response to DNA damage, which suggests a role for this gene as an effector of p53-dependent apoptosis. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRDD

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: RRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: p53-induced death domain-containing protein 1

Protein Size: 753

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57270_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57270_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55367
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×