PKM2 Antibody - N-terminal region : FITC

PKM2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57788_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PKM2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyruvate kinase isozymes M1/M2

Protein Size: 531

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57788_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57788_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5315
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×