PLEK Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PLEK is a major protein kinase C substrate of platelets, its exact function is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLEK

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pleckstrin

Protein Size: 350

Purification: Affinity Purified

• Artikelnummer: AVIARP56397_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56397_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5341
• Wirt: Rabbit