PLEKHA1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PLEKHA1 binds specifically to phosphatidylinositol-3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. PLEKHA1 may recruit other proteins to the plasma membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLEKHA1

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pleckstrin homology domain-containing family A member 1

Protein Size: 404

Purification: Affinity Purified

• Artikelnummer: AVIARP57544_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57544_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 59338
• Wirt: Rabbit