PLS1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The protein encoded by this ge

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLS1

Key Reference: Chafel,M.M., (1995) Dev. Dyn. 203 (2), 141-151

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plastin-1

Protein Size: 629

Purification: Affinity Purified

• Artikelnummer: AVIARP56400_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56400_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5357
• Wirt: Rabbit