PLXNA4 Antibody - middle region : FITC

PLXNA4 Antibody - middle region : FITC
Artikelnummer
AVIARP58514_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This protein mediates semaphorin receptor activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLXNA4

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plexin A4, B, isoform CRA_a EMBL EAW83793.1

Protein Size: 522

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58514_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58514_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Yeast
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 91584
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×