PMM1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PMM1

Key Reference: Barone,R., J. Inherit. Metab. Dis. 30 (1), 107 (2007)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphomannomutase 1

Protein Size: 262

Purification: Affinity Purified

• Artikelnummer: AVIARP56401_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56401_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5372
• Wirt: Rabbit