PNMA3 Antibody - N-terminal region : Biotin

PNMA3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54945_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNMA3

Key Reference: Wills,N.M., (2006) J. Biol. Chem. 281 (11), 7082-7088

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Paraneoplastic antigen Ma3

Protein Size: 463

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54945_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54945_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29944
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×