PNPLA2 Antibody - middle region : HRP

PNPLA2 Antibody - middle region : HRP
Artikelnummer
AVIARP58938_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an enzyme which catalyzes the first step in the hydrolysis of triglycerides in adipose tissue. Mutations in this gene are associated with neutral lipid storage disease with myopathy.

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: RDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Patatin-like phospholipase domain-containing protein 2

Protein Size: 504

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58938_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58938_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 57104
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×