PNPLA2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an enzyme which catalyzes the first step in the hydrolysis of triglycerides in adipose tissue. Mutations in this gene are associated with neutral lipid storage disease with myopathy.

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: RDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Patatin-like phospholipase domain-containing protein 2

Protein Size: 504

Purification: Affinity Purified

• Artikelnummer: AVIARP58938_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58938_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 57104
• Wirt: Rabbit
• Konjugat: Conjugated, HRP