PNPO Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PNPO catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.Vitamin B6, or pyridoxal 5-prime-phosphate (PLP), is critical for normal cellular function, and some cancer cells have notable differences in vitamin B6 metabolism compared to their normal counterparts. The rate-limiting enzyme in vitamin B6 synthesis is pyridoxine-5-prime-phosphate (PNP) oxidase (PNPO; EC 1.4.3.5).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNPO

Key Reference: Song,H., Schizophr. Res. 97 (1-3), 264-270 (2007)

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyridoxine-5'-phosphate oxidase

Protein Size: 261

Purification: Affinity Purified

• Artikelnummer: AVIARP58515_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58515_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55163
• Wirt: Rabbit
• Konjugat: Conjugated, FITC