POLR2C Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes the third largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a cysteine rich region and exists as a heterodimer with another polymerase subunit, POLR2J. These two subunits form a core subassembly unit of the polymerase. A pseudogene has been identified on chromosome 21.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse POLR2C

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA-directed RNA polymerase II subunit RPB3

Protein Size: 332

Purification: Affinity Purified

• Artikelnummer: AVIARP57690_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57690_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5432
• Wirt: Rabbit