POMP Antibody - C-terminal region : FITC

POMP Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56777_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a molecular chaperone that binds 20S preproteasome components and is essential for 20S proteasome formation. The 20S proteasome is the proteolytically active component of the 26S proteasome complex. The encoded protein is degraded before the maturation of the 20S proteasome is complete. A variant in the 5' UTR of this gene has been associated with KLICK syndrome, a rare skin disorder.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human POMP

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: EFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proteasome maturation protein

Protein Size: 141

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56777_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56777_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51371
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×