Pou3f3 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pou3f3 acts as a transcriptional activator in oligodendrocytes; Pou3f3 may play a role in regulation of neural development

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Pou3f3

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: POU domain, class 3, transcription factor 3

Protein Size: 497

Purification: Affinity Purified

• Artikelnummer: AVIARP57888_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57888_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 192109
• Wirt: Rabbit