PPP2R1A Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzy

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP2R1A

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

Protein Size: 589

Purification: Affinity Purified

Subunit: A alpha isoform

• Artikelnummer: AVIARP56742_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56742_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5518
• Wirt: Rabbit