PPP2R1B Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric co

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R1B

Key Reference: Chou,H.C., (2007) Cancer Lett. 253 (1), 138-143

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA FLJ76434, highly similar to Homo sapiens protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), beta isoform (PPP2R1B), transcript variant 2, mRNA EMBL BAF84964.1

Protein Size: 667

Purification: Affinity Purified

Subunit: A beta isoform

• Artikelnummer: AVIARP57781_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57781_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5519
• Wirt: Rabbit