PPP2R5E Antibody - N-terminal region : HRP

PPP2R5E Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56693_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an epsilon isoform of the regulatory subunit B56 subfamily.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R5E

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform

Protein Size: 467

Purification: Affinity Purified

Subunit: epsilon isoform
Mehr Informationen
Artikelnummer AVIARP56693_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56693_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5529
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×