PPWD1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPWD1

Key Reference: Jurica,M.S., (2002) RNA 8 (4), 426-439

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peptidylprolyl isomerase domain and WD repeat-containing protein 1

Protein Size: 646

Purification: Affinity Purified

• Artikelnummer: AVIARP55238_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55238_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23398
• Wirt: Rabbit