PREP Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and d

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PREP

Key Reference: Myohanen,T.T., (2007) Neurochem. Res. 32 (8), 1365-1374

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prolyl endopeptidase

Protein Size: 710

Purification: Affinity Purified

• Artikelnummer: AVIARP56414_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56414_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5550
• Wirt: Rabbit