PrEST Antigen AP1M2

adaptor related protein complex 1 subunit mu 2
Artikelnummer
ATLAPrEST96203-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: PYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS

GeneName: AP1M2

Ensembl Gene ID: ENSG00000129354

UniProt ID: Q9Y6Q5

Entrez Gene ID: 10053

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000003309: 100%, ENSRNOG00000043093: 100%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPrEST96203-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST96203-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 10053
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download