PrEST Antigen C17orf80

chromosome 17 open reading frame 80

Sequence: KLVVDKPEQTVKTFPLPAVGLERAATTKADKDIKNPIQPSFKMLKNTKPMTTFQEETKAQFYASEKTSPKRELAKDLPKSGESRCNP

GeneName: C17orf80

Ensembl Gene ID: ENSG00000141219

UniProt ID: Q9BSJ5

Entrez Gene ID: 55028

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000041623: 37%, ENSRNOG00000024780: 33%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96078-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96078-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 55028
• Konjugat: Unconjugated