PrEST Antigen C1orf146

chromosome 1 open reading frame 146

Sequence: VNAINLMCTIAKTTSKPYIDSICYRMITAKAYIIEQSPVWKTLQKIKLNSDSVNP

GeneName: C1orf146

Ensembl Gene ID: ENSG00000203910

UniProt ID: Q5VVC0

Entrez Gene ID: 388649

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000089798: 85%, ENSRNOG00000047876: 82%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96068-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96068-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 388649
• Konjugat: Unconjugated