PrEST Antigen C20orf96

chromosome 20 open reading frame 96

GeneName: C20orf96

Sequence: KHSGTHSIVQEFQVPDYVPWQQSKQETKPSTLPPVQQANSLHTSKMKTLTRVQPVFHFKPTTVVTSCQPKNPRELHRRRKLDPGKMHAKIWLMKTSLRS

Interspecies Mouse/Rat: ENSMUSG00000032680: 32%, ENSRNOG00000023721: 31%

Entrez Gene ID: 140680

UniProt ID: Q9NUD7

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000196476

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96112-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96112-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 140680