PrEST Antigen C2orf50

chromosome 2 open reading frame 50
Artikelnummer
ATLAPrEST96030-100
Verpackungseinheit
100 µl
Hersteller
Atlas Antibodies

Verfügbarkeit: wird geladen...
Preis wird geladen...
Sequence: PDHVPLFSDTVPSSTNQVVGSRLDTPLGQTLIRMDFFFTEGARKKKLEDQMQ

GeneName: C2orf50

Ensembl Gene ID: ENSG00000150873

UniProt ID: Q96LR7

Entrez Gene ID: 130813

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000071398: 63%, ENSRNOG00000024338: 67%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

Mehr Informationen
Artikelnummer ATLAPrEST96030-100
Hersteller Atlas Antibodies
Hersteller Artikelnummer APrEST96030-100
Verpackungseinheit 100 µl
Mengeneinheit STK
Human Gene ID 130813
Konjugat Unconjugated
Produktinformation (PDF) Download
MSDS (PDF) Download