PrEST Antigen C4orf54

chromosome 4 open reading frame 54

Sequence: FNRNEWKRKSDPLPMMMDSHVLSLIASEEREGVVVADGDHDKLSKRLGEVEERGTGNKAGVVLRGAPIERLQRRNSNPS

GeneName: C4orf54

Ensembl Gene ID: ENSG00000248713

UniProt ID: D6RIA3

Entrez Gene ID: 285556

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSMUSG00000090066: 81%, ENSRNOG00000018517: 29%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96043-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96043-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 285556
• Konjugat: Unconjugated