PrEST Antigen CD1E

CD1e molecule

GeneName: CD1E

Sequence: ISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKP

Interspecies Mouse/Rat: ENSRNOG00000016451: 39%, ENSMUSG00000028076: 42%

Entrez Gene ID: 913

UniProt ID: P15812

Buffer: PBS and 1M Urea, pH 7.4.

Ensembl Gene ID: ENSG00000158488

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96173-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96173-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 913