PrEST Antigen MAF1

MAF1 homolog, negative regulator of RNA polymerase III

Sequence: FSAVREDFKDLKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNKRLKRIVFFSC

GeneName: MAF1

Ensembl Gene ID: ENSG00000179632

UniProt ID: Q9H063

Entrez Gene ID: 84232

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000013514: 99%, ENSMUSG00000022553: 99%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST95968-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST95968-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 84232
• Konjugat: Unconjugated