PrEST Antigen PLA2G4E

phospholipase A2 group IVE

Sequence: KDLLVMVNESFENTQRVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCCRSRKKGPISQPLDCLSDGQVMTLPVGESYELHMKSTPCPE

GeneName: PLA2G4E

Ensembl Gene ID: ENSG00000188089

UniProt ID: Q3MJ16

Entrez Gene ID: 123745

Buffer: PBS and 1M Urea, pH 7.4.

Interspecies Mouse/Rat: ENSRNOG00000024904: 64%, ENSMUSG00000050211: 64%

Atlas Antibodies attaches great importance to sustainability. In the production process of their high quality antibodies, Atlas follows the highest and most rigorous ethical animal welfare standards. The products are produced within Europe, which reduces the supply chain length to a minimum and WoolCool (100% natural sheep wool) is used as an insulating material instead of Styrofoam for the transportation of refrigerated goods.

• Artikelnummer: ATLAPrEST96007-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: APrEST96007-100
• Verpackungseinheit: 100 µl
• Mengeneinheit: STK
• Human Gene ID: 123745
• Konjugat: Unconjugated