PRKAB1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKAB1

Key Reference: Hasumi,H., Gene 415 (1-2), 60-67 (2008)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'-AMP-activated protein kinase subunit beta-1

Protein Size: 270

Purification: Affinity Purified

Subunit: beta-1

• Artikelnummer: AVIARP56699_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56699_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5564
• Wirt: Rabbit