Prkar1a Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Prkar1a is a regulatory subunit of cAMP-dependent protein kinase (PKA); negatively regulates meiosis .

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Prkar1a

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-dependent protein kinase type I-alpha regulatory subunit

Protein Size: 381

Purification: Affinity Purified

• Artikelnummer: AVIARP57831_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57831_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 25725
• Wirt: Rabbit