PRKAR1B Antibody - middle region : Biotin

PRKAR1B Antibody - middle region : Biotin
Artikelnummer
AVIARP56420_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKAR1B

Key Reference: Zhan,X. (2006) Anal. Biochem. 354 (2), 279-289

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-dependent protein kinase type I-beta regulatory subunit

Protein Size: 381

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56420_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56420_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5575
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×