PRKCB1 Antibody - N-terminal region : HRP

PRKCB1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56423_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCB1

Key Reference: Tatematsu,K., (2008) J. Biol. Chem. 283 (17), 11575-11585

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein kinase C beta type

Protein Size: 673

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56423_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56423_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5579
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×