PRKRIP1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PRKRIP1 binds double-stranded RNA.It inhibits EIF2AK2 kinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKRIP1

Key Reference: Yin,Z., (2003) J. Biol. Chem. 278 (25), 22838-22845

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: PRKR-interacting protein 1

Protein Size: 184

Purification: Affinity Purified

• Artikelnummer: AVIARP58810_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58810_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 79706
• Wirt: Rabbit
• Konjugat: Conjugated, HRP