PRPH Antibody - middle region : FITC

PRPH Antibody - middle region : FITC
Artikelnummer
AVIARP56708_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the pe

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRPH

Key Reference: Xiao,S., (2008) J. Neurosci. 28 (8), 1833-1840

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: YKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peripherin

Protein Size: 470

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56708_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56708_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5630
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×