PRPH Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the pe

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRPH

Key Reference: Xiao,S., (2008) J. Neurosci. 28 (8), 1833-1840

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peripherin

Protein Size: 470

Purification: Affinity Purified

• Artikelnummer: AVIARP56707_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56707_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5630
• Wirt: Rabbit