PRR5 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. The protein is a component of the mammalian target of rapamycin complex 2 (mTORC2), and it regulates platelet-derived growth factor (PDGF) receptor beta expression and PDGF signaling to Akt and S6K1. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms. Read-through transcripts from this gene into the downstream Rho GTPase activating protein 8 (ARHGAP8) gene also exist, which led to the original description of PRR5 and ARHGAP8 being a single gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPR5

Molecular Weight: 31 kDa

Peptide Sequence: Synthetic peptide located within the following region: TLVQKVVSPYLGTYGLHSSEGPFTHSCILEKRLLRRSRSGDVLAKNPVVR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: proline-rich protein 5

Protein Size: 287

Purification: Affinity purified

• Artikelnummer: AVIARP58943_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58943_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55615
• Wirt: Rabbit